Table 1 Sequences of the N-terminal helix (Arf) and C-terminal extensions (Rho and Rab) of the His-tagged GTPase constructs used in the present study

The residue carrying the lipid post-translational modification is indicated in bold. The sequences of the tags are underlined.

GTPaseNatural lipidSequence
His-Arf1MyristateGHHHHHHGG GNIFANLFKGLFGKK EMRI …
His-Arf3MyristateGHHHHHHGG GNIFGNLLKSLIGKK EMRI …
His-Arf4MyristateGHHHHHHGG GLTISSLFSRLFGKK QMRI …
His-Arf5MyristateGHHHHHHGG GLTVSALFSRIFGKK QMRI …
His-Arf6MyristateGHHHHHHGG GKVLSKIFGNK EMRI …
RhoG-HisGeranylgeranyl … AVRAVL NPTPIKRGRSCILL HHHHHH
Rac1-HisGeranylgeranyl … AIRAVL CPPPVKKRKRKCLLL HHHHHH
RhoA-HisGeranylgeranyl … ATRAAL QARRGKKKSGCLVL HHHHHH
Cdc42-HisGeranylgeranyl … AILAAL EPPEPTKKRKCKFL HHHHHH
Rab1-HisGeranylgeranyl… EIKKR MGCPGATAGGAEKSNVKIQSTPVKQSGGGCC HHHHHH
Rab35-HisGeranylgeranyl … AKKDN LAKQQQQQQNDVVKLTKNSKRKKRCC HHHHHH